One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit (By similarity). One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit (By similarity). MPSKKDTTPKFHKLHVKTGDTVQVIAGKDKGKVGEVIKALPQLSKVIVKGVNIKTKHVKPQQEGESGRIVTQEAPIHSSNVMLYSTKQNVASRVCYTFTAEGKKVRKLKKTGEILDN Ava_0702 50S ribosomal protein L24 RL24_ANAVT rpl24 rplX 117